Shop SoundAndVision
Refine By


  • Sort By:

simple and easy wireless set up automatically connect if you need the cell phone connect the receiver automatically just turn on t...he bluetooth of the cell phone first and then turn on the bluetooth receiver read more


bluetooth 4.1 adopts bluetooth 4.1 this headphones connect to your phone or tablet up to 32 feet while ensuring robust and clear s...ound comfortable fit with ergonomic design and soft silicone ear hook this in ear bluetooth headphone fits... read more


mpow brand certified top brand bluetooth accessories for smartphones.cheetahs stylish behind ear streamline outlook design 100 stable and comfortable user wearing experience for runningjoggingbikingdrivingfishingcampinghiking and... read more


mpow brand certified top brand bluetooth accessories for smartphones.cheetahs stylish behind ear streamline outlook design 100 stable and comfortable user wearing experience for runningjoggingbikingdrivingfishingcampinghiking and... read more

24.89 35.99

<p><b>Sound Leadership & Voice Clarity</b></p> <p>Featured with CVC6.0 noise cancellation technology, the headphone intelligently ...filters out background noise for perfect speech transmission in busy and noisy environments. Compared to Bluetooth 4.0, the latest Bluetooth 4.1 technology features faster & stable signal transmission, clearer sound quality and lower power consumption.</p> <p><b>Stylish & Versatile Shark Design</b></p> <p>With the built-in intelligent magnet design, you can easily trim the earplug cables when you don?t need them and hang the headphone like a necklace around your neck. Prevents troublesome wires from tangling and provides a natural feel through all-day wear.</p> <p><b>Easy Button Control</b></p> <p>Unlike ordinary Bluetooth earbuds for running and workouts, this comfort-fit earbuds allows for easy and accurate one-touch control located on the neckband, no need to take off the earbuds.</p> <p><b>Hands Free Calling</b></p> <p>Now you do not have to stop what you are doing at hand to answer a call. The wireless Bluetooth headset allows auto switching between music and calls. You can control all functions of music and calls easily via the buttons on the headset. Enjoy a cheerful chat with your friends while you are doing your office work, housework, gardening, or particularly when you are driving along the fast lane.</p> <p><b>Notice:</b></p> <p>To protect the earbud cable against the damage of pulling force, please pinch the earplugs instead of the cables when pulling earplugs out of the shark-like magnet which can ganrantee the lifespan of earbuds by using it in the right way.</p> <p><b>Warranty</b></p> <p>Every Mpow product includes a 45 days money back & 18-month warranty.</p> read more


<p><b>Sound Leadership & Voice Clarity</b></p> <p>Featured with noise cancellation technology, the headphone intelligently filters... out background noise for perfect speech transmission in busy and noisy environments and reduces background noise, such as car road noise and air conditioning fans for clearer sound. Noise cancelling microphone further guarantees clear sound for hands-free calls.</p> <p><b>Wireless Freedom</b></p> <p>With a battery life of 8 hours continuous wireless playback, our product won't let you down. However, if you do find yourself unable to recharge, you have the option of using the included audio cable(Wired mode without microphone). The headphone is optimized for portable audio including mp3, CD players, iPad, iPod iPhone, and other Bluetooth mobile devices.</p> <p><b>Hands Free Calling</b></p> <p>Now you do not have to stop what you are doing at hand to answer a call. The wireless Bluetooth headphone allows auto switching between music and calls. You can control all functions of music and calls easily via the buttons on the headset. Enjoy a cheerful chat with your friends while you are doing your office work, housework, gardening, or particularly when you are driving along the fast lane.</p> <p><b>Foldable and Portable Design</b></p> <p>The foldable design makes the headphone easy to take along on vacation or business trip. You can store it in your bag for use at work when you need to focus. </p> <p><b>Wearing Comfort</b></p> <p>Super soft ear cushions help lock your ear snugly and the ultra-light weight of the overhead headphone does not cause any burden to the ears, thus providing lasting wearing comfort.</p> <p><b>Warranty</b></p> <p>Every Mpow product includes a 45 days money back & 18-month warranty.</p> read more

34.69 45.99

<p><b>Immersive Hi-Fi Sound</b></p> <p>Designed for an excellent listening experience, Mpow Bluetooth headset with CSR chip and ar...ound-ear cushion design can provide robust, immersive and Hi-fidelity sound.</p> <p><b>Advanced Compatibility</b></p> <p>The Bluetooth headset can easily and quickly connect with smartphones, tablets, TVs and other Bluetooth devices within 33 feet, bringing you crystal clear sound effect. PLEASE make sure the driver software of receiving adapter is fully updated when connected to PC or laptop, and you need a SEPARATE Bluetooth adapter when connected with TV.</p> <p><b>Foldable and Portable Design</b></p> <p>The foldable design makes it easy to store them when not in use or during travels. The stainless steel slider headband allows you to find the perfect fit and provide excellent durability. </p> <p><b>Dual mode: Wireless & Wired</b></p> <p>In the wireless mode: With a built-in 420mAh battery which provides 13 hours' continuous wireless playback and let you get rid of the tangled cables on the move; <br> In the wired mode: Used as a wired headphone with an audio cable.</p> <p><b>Note: </b></p> <p>1. Please keep the headset in dry and cool environment as the earmuff is made of memory-protein materials. <br>2. The microphone only works in the wireless mode. </p> <p><b>Specification</b></p> <p>Bluetooth Version: 4.0<br> Range: 33 feet (10 meters)<br> Talking Time: Around 15 hours<br> Playback Time: Around 13 hours<br> Charging Time: 4 hours<br> Charging Voltage: 5V<br> Battery Capacity: 420mAh<br> </p> <p><b>Packing List</b></p> <p>1x Mpow Bluetooth Headset<br> 1x 3.5mm Audio Cable<br> 1x USB Charging Cable<br> 1x Packing Bag<br> 1x User Manual<br> </p> <p><b>Warranty</b></p> <p>Every Mpow product includes a 45-day money back & 18-month warranty.</p> read more

19.49 25.99

<b>Multi-function</b><br><br>You can listen to your favorite music from your mobile device to this transmitter via Bluetooth and t...his gadget transmits signal to any unused FM radio station on your car stereo. You can also use it to charge your cell phone when you are driving. <br><br> <b>Easy Installation</b><br><br>Fast Bluetooth pairing, pair once only, auto-connect next time if your phone's Bluetooth is turned on. <br><br><b>Goose-Neck Design</b><br><br> The flexible metal hose is designed to be goose neck shape, which allows you to adjust the its direction conveniently. <br><br><b>Specifications:</b><br><br>Bluetooth Version: V3.0 + EDR; <br>Effective Bluetooth Range: 10 meters; <br>FM Frequency: 87.5MHz - 108.0MHZ; <br> Working Voltage: 10V~24V; <br>Audio Input/Output: 3.5mm audio interface; <br> USB Charging Port: 5V/2.1A. <br><br><b>NOTE:</b><br><br>1.This FM transmitter is compatible with most cars, but not all. Please ensure your car space is big enough to accommodate this car kit; <br>2.To prolong the lifespan of this product, please do not violently rotate the head of this product when you use it (the rotation angle shall not exceed 90 degree) ; <br>3.For the best sound quality, please tune it to an unused frequency; if there is interference when listening to music, please tune to another frequency; <br>4.The max output current of the transmitter varies with charged devices, because charged devices can limit output current automatically. The input current also varies with charged devices, lower the power, larger the input; <br>5.If you want to change the way to play music, please pause the music first and then connect it to your MP3, MP4 or other devices through 3.5mm audio cable to stream music. <br><br><b>Package Included:</b><br><br>1x Bluetooth FM transmitter; <br>1x User Manual; <br>1x Audio Cable(1m) ; <br><br><b>Warranty</b><br><br>Every Mpow Product includes a 45 Day refund, 18-month worry-free Guarantee! read more

21.69 28.99

<b>Wireless Sport Headphones</b><br> <br> Specially designed for sports enthusiast, the perfect music partner for sports and<br> <br> <b>Robust & Dynamic Sound</b><br> <br> Adopt Bluetooth 4.1, this sports headphone offers incredible sound quality with deep extremely deep, distortion-free bass and truer sounds and delivers stable and strong signal than the general Bluetooth headset in a 32-feet working distance.<br> <br> <b>Handsfree Function</b><br> <br> This Bluetooth headset can provide the true hands-free convenience and exceptional ease-of-use, so that you you can get hands-free phone conversation with clear voice even in noisy environment like inside a gym and running/cycling on the road.<br> <br> <b>Metal-constructed Shell</b><br> <br> Featured with exquisite metal-constructed shell, this in-ear headphones is well-designed and high-end that can create the metal sound chamber.<br> <br> <b>Multipoint Function</b><br> <br> The three smart button in-line control with microphone allows you conveniently control your music-playing options and answer or end calls.<br> <br> <b>Package Includes:</b><br> <br> 1 x Mpow Coach Bluetooth Sport Headphone<br> 3 x Ear Tips(Small, Medium, Large)<br> 1 x Micro USB Charge Cable<br> 3 x Indoor Leisure Fit Ear Hooks<br> 3 x Outdoor Sport Fit Ear Hooks<br> 1 x User Manual read more


<b>Features</b><br><br>1. Provides hands-free calling through car speakers, set free your hands during driving.<br>2. USB Charging... Port, 5V/2.1A car charger can charges your favorite mobile devices fast, and it can automatically adjust the outputpower to different smart phone.<br>3. Large 1.44 inch LED Display Screen, enable to show you the current voltage of the storage battery of your car, the name of songs or caller ID.<br>4. Auto-Connect, pair once only, auto-connect next time if your phone??s Bluetooth is turned on first.<br>5. Gooseneck Design, the flexible metal hose is designed to be goose neck shape, which allows you to adjust its direction conveniently.<br><br><b>Specifications</b><br><br>Bluetooth Version: V3.0 + EDR;<br>Effective Bluetooth Range: 10 meters;<br>FM Frequency: 87.5MHz - 108.0MHZ;<br>Working Voltage: 10V~24V;<br>Audio Input /Output: 3.5mm audio interface;<br>USB Charging Port: 5V/2.1A.<br><br><b>NOTE</b><br><br>1.This FM transmitter is compatible with most cars, but not all. Please ensure your car space is big enough to accommodate this car kit;<br>2.To prolong the lifespan of this product, please do not violently rotate the head of this product when you use it (the rotation angle shall not exceed 90 degree) ;<br>3.For the best sound quality, please tune it to an unused frequency; if there is interference when listening to music, please tune to another unused frequency;<br>4.The max output current of the transmitter varies with charged devices, because charged devices can limit output current automatically. The input current also varies with charged devices, lower the power, larger the input;<br> 5.If you want to change the way to play music, please pause the music first and then try another mode to play.<br><br><b>Package Included: </b><br><br>1x Bluetooth FM transmitter;<br>1x User Manual;<br>1x Audio Cable(3ft);<br><br><b>Warranty</b><br><br>Every Mpow Product includes a 45 Day refund, 18-month worry-free Guarantee! read more


<p><b>Stereo Hi-Fi Sound</b></p> <p>Designed for an excellent music & communication experience, Mpow headset adopts the best CSR c...hip together with CVC6.0 noise cancelling technology for isolating outside noise, providing rich and dynamic audio. </p> <p><b>Advanced Compatibility</b></p> <p>The Bluetooth headset can easily and quickly connected with smartphones, tablets, TVs and other Bluetooth devices within 33 feet, bringing you crystal clear sound effect. PLEASE make sure the driver software of receiving adapter is fully updated when connected to PC or laptop, and you need a SEPARATE Bluetooth adapter when connected with TV.</p> <p><b>Foldable and Portable Design</b></p> <p>The foldable design makes it easy to store them when not in use or during travels. The stainless steel slider headband allows you to find the perfect fit and provide excellent durability. </p> <p><b>Dual mode: Wireless & Wired</b></p> <p>In the wireless mode: With a built-in 420mAh battery which provides 13 hours' continuous wireless playback and let you get rid of the tangled cables on the move; In the wired mode: Used as a wired headphone with an audio cable.</p> <p><b>Note: </b></p> <p>1.Please keep the headset in dry and cool environment as the earmuff is made of memory-protein materials. <br> 2.Microphone only works in the wireless mode. </p> <p><b>Specification</b></p> <p>Bluetooth Version: 4.0<br> Range: 33 feet (10 meters)<br> Talking Time: Around 15 hours<br> Playback Time: Around 13 hours<br> Charging Time: 4 hours<br> Charging Voltage: 5V<br> Battery Capacity: 420mAh<br> </p> <p><b>Packing List</b></p> <p>1x Mpow Bluetooth Headset<br> 1x 3.5mm Audio Cable<br> 1x USB Charging Cable<br> 1x Packing Bag<br> 1x User Manual<br> </p> <p><b>Warranty</b></p> <p>Every Mpow product includes a 45-day money back & 18-month warranty.</p> read more


<p><b>Mpow Enchanter Bluetooth Earbuds</b></p> <p><b> </b></p> <p><b>Sound Leadership</b></p> <p>The latest Bluetooth 4.1 and best CSR chip provide strong signal quickly and easily connecting, giving these wireless earbuds robust stereo sound quality.</p> <p><b>Voice Clarity</b></p> <p>Featured with noise cancellation technology, the headphone intelligently filters out background noise for perfect speech transmission in busy and noisy environments and reduces background noise, such as car road noise and air conditioning fans for clearer sound. 3 pairs of ear cups are supplied which isolate ambient noise well when listening to music. </p> <p><b>Designed for Sports</b></p> <p>No worry for sweat out any more, the circuit board inside earphone is coated with sweat-proof and corrosion-resistant nano-material, which greatly protects sport headphones from sweat and water.</p> <p><b>Hands Free Calling</b></p> <p>Now you do not have to stop what you are doing at hand to answer a call. The wireless Bluetooth headphone allows auto switching between music and calls. You can control all functions of music and calls easily via the buttons on the headset. Enjoy a cheerful chat with your friends while you are doing your office work, housework, gardening, or particularly when you are driving along the fast lane.</p> <p><b>Product Specification</b></p> <p>Bluetooth Version: V4.1<br> Charging Time: ?2 hours<br> Standby Time: 400 Hours<br> Play Time: 6 Hours<br> Talk Time: 7 Hours<br> Bluetooth Profile: AVRCP/A2DP/HSP/HFP<br> Battery: 3.7V / 100mAh<br> </p> <p><b>Warranty</b></p> <p>Every Mpow product includes a 45 days money back & 18-month warranty.</p> read more